PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00177g00124.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 330aa    MW: 35575 Da    PI: 7.3845
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00177g00124.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.7e-1474118347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE+ l++ + ++lG+g+W+ Iar + + Rt+ q+ s+ qky
  Peaxi162Scf00177g00124.1  74 PWTEEEHRLFLLGLQKLGKGDWRGIARNFVTSRTPTQVASHAQKY 118
                               8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.105.4E-4322IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.40567123IPR017930Myb domain
SuperFamilySSF466892.02E-1671124IPR009057Homeodomain-like
SMARTSM007177.2E-1171121IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.9E-1872122IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.0E-1173117IPR009057Homeodomain-like
CDDcd001674.34E-1074119No hitNo description
PfamPF002492.0E-1174118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MTRRCSHCNH NGHNSRTCPT RGGGSGGGGG GGVRLFGVRL TDGSIMKKSA SMGNLSSYSS  60
SLAAVSPNNL PGVPWTEEEH RLFLLGLQKL GKGDWRGIAR NFVTSRTPTQ VASHAQKYFI  120
RQSNATRRKR RSSLFDIVAD TATDAPHPFP EEQIMLPPRA IEGDKEQSTL SATKAVETDF  180
ADSLPSLDLS LKSDFESMEI TPSEVEETKQ NTTTNGIPPV FPAFFPAYIP VPYPFWPSNT  240
IPVHEDKGAE PSHHQILKPI PTVAKEPVNV DELVGMSQLT LADAGSGHIE PSPLSLKLTA  300
EPSRQSAFHA STPVKSSEIT KGETAPIQAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755241e-162HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626737.10.0PREDICTED: transcription factor MYB1R1
TrEMBLK4DFE70.0K4DFE7_SOLLC; Uncharacterized protein
STRINGSolyc12g044610.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117701922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.15e-67MYB_related family protein